PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00022778001
Common NameGSBRNA2T00022778001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 362aa    MW: 40258.8 Da    PI: 9.4752
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00022778001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.1e-38106166262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+ss
  GSBRNA2T00022778001 106 PQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSS 166
                          6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-30105164IPR003851Zinc finger, Dof-type
PfamPF027018.9E-33108164IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.705110164IPR003851Zinc finger, Dof-type
PROSITE patternPS013610112148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGFYRPDNTA PMKLISNSVL KLFLDRAGFE CMFFMDATKW TQGFQEMINV KPMDQMISNT  60
NNNTSQQQQP TFITTTTRPN ATAANGGSGG NNNNTAATME TRKARPQEKV NCPRCNSTNT  120
KFCYYNNYSL TQPRYFCKGC RRYWTEGGSL RNVPVGGSSR KNKRSSTPLP SHSNPKLPDL  180
NPPILFSSQI PNKSSKDLNL LSFPVMQDHH HGMSQFLHMP KIENNNTSSS IYASSSPVSA  240
LELLRSNGVS SRGMNTFLPG QMMDSNSVIY SSLGFPTMVD YKQSNNNLSF SIDHHQGIGN  300
NTINSNQRTE DNNHTDDMNG ASRILFPFSD MKELSSTTQD KSHGNNTYWS GMFTNTGGSS  360
W*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.144941e-58seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794810.0JN979481.1 Brassica rapa subsp. pekinensis auxin response factor 18-1 (ARF18-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013663914.10.0PREDICTED: dof zinc finger protein DOF3.7-like isoform X1
SwissprotQ433850.0DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A078J5990.0A0A078J599_BRANA; BnaA09g55570D protein
STRINGBra007632.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.40.0Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]